I have a syntax error in a file that is involves an error message with a curly bracket:

The msg here: https://github.com/rubik/radon/blob/8db8eac6b93aca1eea818060b62350a7cf6a7d36/radon/cli/__init__.py#L353

I imagine contains the curly bracket which causes an issue at the format call here:

https://github.com/rubik/radon/blob/8db8eac6b93aca1eea818060b62350a7cf6a7d36/radon/cli/__init__.py#L3

Integrate: https://github.com/click-contrib/click-completion

Add how-to documentation for inequalities.

Should demonstrate:

• using validate.interval() to create left- and right-bounded intervals (for greater-than-or-equal-to and less-than-or-equal-to)
• using functions for implementing greater-than or less than (but not equal-to)
• and maybe interval disjunction (e.g. a combined x < min or max < x)

Well, Highcharts depends on JS. We should add a note telling people with disabled JS that the site depends on JS.

A really simple task. The best first issue. We have a huge lack of tests. Write tests for anything inside, be creative 🔥

Is your feature request related to a problem? Please describe.
All the data need to be logged. That's why I think that the logging must be added to the image-comparison.

Describe the solution you'd like
The solution is to add SLF4J based on Log4j 2.* version.

Describe alternatives you've considered
Instead of the Log4J can be used Logback or even JUL(java.util.logging).
Th

Prepare a PoC and a manual how to make use of browsers different than Google Chrome.

Eg. the convention

TheAssembly.WithNameMatching("MyApp.DbUp")
  .MustConformTo(Convention.MustHaveFilesBeEmbeddedResources(".sql"))
  .WithFailureAssertion(Assert.Fail);

Does not detect files that have been imported like

<ItemGroup>
  <EmbeddedResource Include="Scripts\*.sql" />
</ItemGroup>

It's time to properly handle the documentation :). This is a summary ticket for all tasks related to the docs update.

• migrate whatever is worth and still true from the wiki to our docs site
• document the new functionality related to interfaces handling
• document the setup with various cloud providers, e.g. SauceLabs, Crossbrowsertesting, etc. (#69)
• running tests in para

The build steps that we have above execute in the order:

• install node
• npm install
• es lint
• sass lint
• install test suite
• run tests

However, when looking on probo.ci the install node task is showing up after sass lint.

Write a section under Help, in the visualiser, to make clearer what each metric and issue means. For instance, provide basic instructions on how to fix high Cyclomatic Complexity numbers, and so on.

item: 1070, class: 9 "Highway overlaps"

There should be an exception for highway=elevator and highway=pedestrian
when they are closed lines (areas), because they can be drawn as an area and areas may have a common edge.

Before adding a new testing tool, please follow the contributing guide:

Search previous suggestions before making a new one, as yours may be a duplicate.
Make an individual pull request for each suggestion.
Chose the corresponding section.
New categories or improvements to the existing categorization are welcome.
Research if the tool you're including is actually awesome and useful. THanks

Situation

Unfortunately Eclipse can't configure the XML formatter settings on a per-project level. So we have to establish a common configuration via textual description.

Acceptance Criteria

1. Formatter settings are described
2. Description is referenced in contribution guide

Proper setup of groups and projects in SQUAD is crucial for effective use of the tool. Right now the information about possible settings and their impact is scattered in various parts of the documentation. Some options are not described and one needs to look at the source code in order to understand their impact. Proposed administration guide should cover above mentioned topics as well as best pra

We should make it clearer to users that they shoudl consider # of hits and stars together: more hits = more confidence in stars....

reason this came up:

• not sure we should be reporting on something like the following (only 7 swissprot hits).

  augustus_masked-scaffold63-processed-gene-0.1-mRNA-1 protein AED:1.00 eAED:1.00 QI:0|0|0|0|1|1|4|0|197
  MFQTGAVKIIANTVPWHQSYSATADHLIAVTWLPVVMCGAVPAM